Identifiers and Description

Gene Model Identifier

Contig9580.0.g31

Standard Name

AAA1

Aliases

Contig9580_0_g31

Description

ATPase family associated with various cellular activities (AAA)

Genome Browser

GBrowse

Genome Browser (Micronucleus)

Micronuclear Genome Browser

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
T. thermophilaTTHERM_010792607.001515989747033e-72ATPase, AAA family protein
SGDYMR089C6.997942222381785e-66YTA12 SGDID:S000004695, Chr XI
II from 448086-445609, Ge...

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>Contig9580.0.g31(coding)
ATGAACGATAACAAAAATCACTCGTCATAGCAGAGTGACTTAGAACAAAATAAGCGCTCT
TCACTTTAGAATGAGCTTTAGAAAAGCAACCAAGGACATGATCATGAATATGGTAGTTAT
AGACAGAAGATTATGAGAATGTGGGAATGGCTGGTTGACATCTTGAAGTCGAAGACATTC
TTGAGAGCATTCTCAATAGCAGCATTAATTTATGCATCAATCAAGGTGAAGGGGCTCTAT
GATTCAACACTCCCAATTAGTGACACTTTGCATTTAATTAAAATGGGAGAATTTAAGAAG
GTAATTGTTGGGAGTTTGTTCTTAATATGCTACTTCAAATCTCCTTAACAAGGAATGCAA
TATTGCATCGCAAATCGCTCCTTAATATCAGAAGAAGGCTTAGCTCAGTCTTTGCACACA
AGTCAAACTACCTTCACTAGTCCTCTTATTAATGAAACATAAATTGGGTATTTAATGGCT
GCTGGCATCTACTCATATATCGTATACAGACTAATAACTAACTTGAAAGACATGCATGGT
TTCAAAGGGAAGACAAAGAAAGACATGATTGGAGAATAAAAACTCAAGGATTTCTAAGAT
ATTGGAGGTTGTTTGACTGCTAAGAATGCTTTGAGAGATGTCATTGACTGCATCAAGAGA
CCAGAACTCTACAAGCAGGCAGGAGTCAGGATGCCAAAGGGAGTGTTGCTCTATGGCCCA
CCAGGCACTGGAAAAACTCTTATTGCAAAAGCTGCAGCAACTGAAGCAGGCATACCTGTC
ATTTATTGTAGTGGCTCTGAGTTTGTTGAAGTGTTTGTTGGATTAGGAGCAAAAAGAATT
AGAAGTGTATTTGACTAAGCTAGATAACAATCCCCATGCATGATATTTATTGATGAAATA
GACGCAGTTGGTTTTTCAAGAGGAAATAATAATTACATAATGGGCGGTGGTCACAGAGAA
ATGGAAACTACTCTGAATGAGTTACTCAACTAAATGGATGGTTTCGAAGAAAATGATAAG
ATTTTGGTGGTAGCAGCTACAAATTTAGCTAATACATTAGATCCTGCTCTTCAAAGACCT
GGTAGATTTGATTAGAAAATTGAGATTAAATTGCCAACACTCGAAGAAAGAGTTGACATC
TTCAAGATTCACCTTAAAAATAAATAACATTCATTATAAGACAAAGACTTATAATTGGCA
GCTAAATACACTGAGGGGTGTTCAGGTGCAGAAATAGAAAACGTAGTTAATCTTGCTGCT
CTTTAATCAGTAAGAAAGGCTCAATCACTAAAATTAACGCAAGTTAACTTAGTGGGAGAA
GAATTTATAGGATACGTGGAATATTTCATATAAGAGAAGAGAAAGATGAATAATGTTGGC
ATGTAAAACTAACAACCACACCACTACTATCGTTAATGA


>Contig9580.0.g31(protein)
MNDNKNHSSQQSDLEQNKRSSLQNELQKSNQGHDHEYGSYRQKIMRMWEWLVDILKSKTF
LRAFSIAALIYASIKVKGLYDSTLPISDTLHLIKMGEFKKVIVGSLFLICYFKSPQQGMQ
YCIANRSLISEEGLAQSLHTSQTTFTSPLINETQIGYLMAAGIYSYIVYRLITNLKDMHG
FKGKTKKDMIGEQKLKDFQDIGGCLTAKNALRDVIDCIKRPELYKQAGVRMPKGVLLYGP
PGTGKTLIAKAAATEAGIPVIYCSGSEFVEVFVGLGAKRIRSVFDQARQQSPCMIFIDEI
DAVGFSRGNNNYIMGGGHREMETTLNELLNQMDGFEENDKILVVAATNLANTLDPALQRP
GRFDQKIEIKLPTLEERVDIFKIHLKNKQHSLQDKDLQLAAKYTEGCSGAEIENVVNLAA
LQSVRKAQSLKLTQVNLVGEEFIGYVEYFIQEKRKMNNVGMQNQQPHHYYRQ